Skip to product information
1 of 1

ABclonal

Recombinant Mouse IFN-gamma Protein - RP01070

Recombinant Mouse IFN-gamma Protein - RP01070

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse IFN-gamma Protein

Sizes: 20ug, 50ug, 100ug

Catalogue Numbers: RP01070-20, RP01070-50, RP01070-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse IFN-gamma Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Cys155) of mouse Interferon Gamma (Accession #NP_032363.1) fused with an Fc, 6×His tag at the C-terminus.

Alternate Names: IFG, IFI, IFN gamma, Interferon Gamma, IFNG

SWISS: P01580

GeneID: 15978

Species: Mouse

Purity: ≥ 90 % as determined by SDS-PAGE; ≥ 90 % as determined by HPLC.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Interferon-gamma (IFN-gamma ) is a secreted protein which belongs to the type II interferon family. IFN-gamma is produced by a variety of immune cells under inflammatory conditions, notably by T cells and NK cells. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. Interferon-gamma is a central regulator of the immune response and signals via the Janus Activated Kinase (JAK)-Signal Transducer and Activator of Transcription (STAT) pathway.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized recombinant Mouse IFNGR1 at 0.2 μg/mL (100 μL/well) can bind recombinant Mouse IFNG, the EC50 of Mouse IFNG is 2.2 ng/mL.|2.M0 macrophages(Catalog # RP01216S) can be induced differentiation into M1 macrophages(CD86+CD206-) by Recombinant Mouse IFN-gamma Protein (50ng/mL) and LPS (100ng/mL).

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: MNATHCILALQLFLMAVSGCYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details