Recombinant Mouse IFNA1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01719-10, RP01719-20, RP01719-50, RP01719-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IFNA1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys24-Lys189) of mouse IFNA1 (Accession #NP_034632.2) fused with and a 6×His tag at the C-terminus.
Alternate Names: Ifa1; If1ai14; IFNA1
SWISS: P01572
GeneID: 15962
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: IFNA1, also known as IFN-alpha and IFNA, belongs to the alpha/beta interferon family. Interferons(IFNs) are proteins made and released by host cells in response to the presence of pathogens such as viruses, bacteria, parasites, or tumor cells. They belong to the large class of glycoproteins known as cytokines. IFNs stimulate the production of two enzymes: a protein kinase and an oligoadenylate synthetase. They allow for communication between cells to trigger the protective defenses of the immune system that eradicate pathogens or tumors. IFNs can activate immune cells, such as natural killer cells and macrophages; they increase recognition of infection or tumor cells by up-regulating antigen presentation to T lymphocytes, and they also increase the ability of uninfected host cells to resist new infection by the virus. Leukocyte interferon is produced predominantly by B lymphocytes. Immune interferon is produced by mitogen- or antigen-stimulated T lymphocytes. IFNA1 is produced by macrophages and has antiviral activities.
Bio-Activity: Measured in a cell cytotoxicity assay using TF-1 cells. The ED50 for this effect is 0.10‑0.40 μg/mL, corresponding to a specific activity of 2.48×10^3 ~9.91×10^3 units/mg.
Source: HEK293 cells
Tag: C-6His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only