ABclonal
Recombinant Mouse IgE Protein - RPT0013
Recombinant Mouse IgE Protein - RPT0013
Couldn't load pickup availability
Recombinant Mouse IgE Protein
Sizes: 50ug, 100ug
Catalogue Number: RPT0013-50, RPT0013-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IgE Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro50-Lys388) of mouse IgE (Accession #) fused with and 6×His tag at the C-terminus.
Alternate Names: IgE
SWISS: P06336
Species: Mouse
Purity: ≥ 95% as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: As one of the five designated immunoglobulin isotypes, immunoglobulin E (IgE) plays a major role in atopic conditions by inducing immediate hypersensitivity reactions. IgE also contributes significantly to the body’s immune response to parasitic infections. IgE antibodies are predominantly found in the tissues, firmly attached to effector cells, such as mast cells and basophils, by high-affinity IgE Fc receptor (Fc epsilon RI) and low-affinity IgE receptor (Fc epsilon RII).
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse IgE (Catalog: RPT0013) at 1 μg/mL (100 μL/well) can bind Mouse IgE Rabbit mAb(Catalog: A23195) with a linear range of 0.06-0.45 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: PALGSELKVTTSQVTSWGKSAKNFTCHVTHPPSFNESRTILVRPVNITEPTLELLHSSCDPNAFHSTIQLYCFIYGHILNDVSVSWLMDDREITDTLAQTVLIKEEGKLASTCSKLNITEQQWMSESTFTCKVTSQGVDYLAHTRRCPDHEPRGVITYLIPPSPLDLYQNGAPKLTCLVVDLESEKNVNVTWNQEKKTSVSASQWYTKHHNNATTSITSILPVVAKDWIEGYGYQCIVDHPDFPKPIVRSITKTPGQRSAPEVYVFPPPEEESEDKRTLTCLIQNFFPEDISVQWLGDGKLISNSQHSTTTPLKSNGSNQGFFIFSRLEVAKTLWTQRK
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
