ABclonal
Recombinant Mouse IGF-I Protein - RP01887
Recombinant Mouse IGF-I Protein - RP01887
Couldn't load pickup availability
Recombinant Mouse IGF-I Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01887-10, RP01887-20, RP01887-50, RP01887-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IGF-I Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly49-Ala118) of Mouse IGF-I (Accession #NP_001104745.1) fused with a hFc tag at the N-terminus.
Alternate Names: Igf1, Igf-1, Insulin-like growth factor I, IGF-I, Somatomedin
SWISS: P05017
GeneID: 16000
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Insulin-like growth factor I, also known as somatomedin C, is the dominant effector of growth hormone and is structurally homologous to proinsulin. Mouse IGF-I/IGF-1 is synthesized as two precursor isoforms with alternate N- and C-terminal propeptides. These isoforms are differentially expressed by various tissues. The 7.6 kDa mature IGF-I/IGF-1 is identical between isoforms and is generated by proteolytic removal of the N- and C-terminal regions. Mature mouse IGF-I/IGF-1 shares 94% and 99% aa sequence identity with human and rat IGF-I/IGF-1, respectively, and exhibits cross-species activity. It shares 60% aa sequence identity with mature mouse IGF-II/IGF-2. Circulating IGF-I/IGF-1 is produced by hepatocytes, while local IGF-I is produced by many other tissues in which it has paracrine effects. IGF-I induces the proliferation, migration, and differentiation of a wide variety of cell types during development and postnatally. IGF-I regulates glucose and fatty acid metabolism, steroid hormone activity, and cartilage and bone metabolism. It plays an important role in muscle regeneration and tumor progression. IGF-I binds IGF-I R, IGF-II R, and the insulin receptor, although its effects are mediated primarily by IGF-I R. IGF-I association with IGF binding proteins increases its plasma half-life and modulates its interactions with receptors.
Source: HEK293 cells
Tag: N-hFc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
