Skip to product information
1 of 1

ABclonal

Recombinant Mouse IgG1 Protein - RPT0017

Recombinant Mouse IgG1 Protein - RPT0017

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse IgG1 Protein

Sizes: 50ug, 100ug

Catalogue Number: RPT0017-50, RPT0017-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse IgG1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence Val98-Lys324 of MouseIgG1(Accession #P01868-1) fused with no tag.

Alternate Names: IgG1, Ighg1, Igh-4, Ig gamma-1 chain C region secreted form,

SWISS: P01868-1

Species: Mouse

Purity: ≥ 90% as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: As a monomeric immunoglobulin that is predominately involved in the secondary antibody response and the only isotype that can pass through the human placenta, Immunoglobulin G (IgG) is synthesized and secreted by plasma B cells, and constitutes 75% of serum immunoglobulins in humans. IgG antibodies protect the body against the pathogens by agglutination and immobilization, complement activation, toxin neutralization, as well as antibody-dependent cell-mediated cytotoxicity (ADCC). IgG tetramer contains two heavy chains (5 kDa ) and two light chains (25 kDa) linked by disulfide bonds, that is the two identical halves form the Y-like shape. IgG is digested by pepsin proteolysis into Fab fragment (antigen-binding fragment) and Fc fragment ("crystallizable" fragment). IgG1 is most abundant in serum among the four IgG subclasses (IgG1, 2, 3 and 4) and binds to Fc receptors (FcγR ) on phagocytic cells with high affinity.

Source: HEK293 cells

Tag: NO-tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: PRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details