Skip to product information
1 of 1

ABclonal

Recombinant Mouse IgG2B Protein - RPT0025

Recombinant Mouse IgG2B Protein - RPT0025

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse IgG2B Protein

Sizes: 20ug, 100ug

Catalogue Number: RPT0025-20, RPT0025-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse IgG2B Protein Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu97-Lys335) of Mouse IgG2b (Accession #P01867-2) fused with a His tag at the N-terminus.

Alternate Names: Ighg2b, Igh-3, Ig gamma-2B chain C region , Immunoglobulin heavy constant gamma 2B

SWISS: P01867-2

Species: Mouse

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: IgG2b,Type I receptor for TGF-beta family ligands BMP9/GDF2 and BMP10 and important regulator of normal blood vessel development. On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. May bind activin as well.

Source: HEK293 cells

Tag: N-His

Formulation: Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

Antigen Sequence: PSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only

View full details