ABclonal
Recombinant Mouse IgG2B Protein - RPT0025
Recombinant Mouse IgG2B Protein - RPT0025
Couldn't load pickup availability
Recombinant Mouse IgG2B Protein
Sizes: 20ug, 100ug
Catalogue Number: RPT0025-20, RPT0025-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IgG2B Protein Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu97-Lys335) of Mouse IgG2b (Accession #P01867-2) fused with a His tag at the N-terminus.
Alternate Names: Ighg2b, Igh-3, Ig gamma-2B chain C region , Immunoglobulin heavy constant gamma 2B
SWISS: P01867-2
Species: Mouse
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: IgG2b,Type I receptor for TGF-beta family ligands BMP9/GDF2 and BMP10 and important regulator of normal blood vessel development. On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. May bind activin as well.
Source: HEK293 cells
Tag: N-His
Formulation: Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Antigen Sequence: PSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
