ABclonal
Recombinant Mouse IL-1 beta Protein - RP01340
Recombinant Mouse IL-1 beta Protein - RP01340
Couldn't load pickup availability
Recombinant Mouse IL-1 beta Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01340-10, RP01340-20, RP01340-50, RP01340-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IL-1 beta Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val118-Ser269) of mouse IL-1 beta (Accession #NP_032387.1) fused with 6×His tag at the C-terminus.
Alternate Names: IL-1 beta, IL-, Il-1b, IL-1beta, Il1b
SWISS: P10749
GeneID: 16176
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interleukin-1 beta (IL1 beta or IL1B) also known as catabolin, is a member of the interleukin 1 cytokine family.This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Mouse IL1B at 10 μg/mL (100 μL/well) can bind Human IL1R2 with a linear range of 0.03125-0.8036 μg/mL.|2.Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is 42.1-168.4 pg/mL, corresponding to a specific activity of 5.94×10^6 -2.37×10^7units/mg.
Source: E. coli
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVAL GLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNW YISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
