Skip to product information
1 of 1

ABclonal

Recombinant Mouse IL-11 Protein - RP02904

Recombinant Mouse IL-11 Protein - RP02904

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse IL-11 Protein

Sizes: 10ug, 20ug

Catalogue Number: RP02904-10, RP02904-20

Citations, Manuals and MSDS Available upon request.

Description: Recombinant mouse IL-11 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Pro-Leu199) of mouse IL-11 (Accession #) fused with additional amino acid free.

Alternate Names: IL11; IL-11; IL-11Oprelvekin; interleukin 11; interleukin-11; Oprelvekin

SWISS: P47873

GeneID: 16156

Species: Mouse

Purity: ≥ 95% as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: IL-11 (Interleukin 11) is a pleiotropic cytokine in the IL-6 family, which also includes LIF, CNTF, Oncostatin M, Cardiotrophin-1, IL-27 and IL-31 (1-4). In humans, IL-11 was also independently discovered as an adipogenesis inhibitory factor (AGIF) (3). The mouse IL-11 cDNA encodes a 199 amino acid (aa) precursor, which generates a 178 aa, 19 kDa mature unglycosylated protein. Mature mouse IL-11 shares 88%, 97%, and 89% aa sequence identity with human, rat and canine IL-11, respectively. IL-11 is secreted by osteoblasts, synoviocytes, fibroblasts, chondrocytes, intestinal myofibroblasts, and trophoblasts, among other cell types (1). It is found in the plasma mainly during inflammation, such as that associated with viral infection, cancer, or inflammatory arthritis, and is considered to be primarily anti-inflammatory (1). It stimulates hematopoiesis and thrombopoiesis, regulates macrophage differentiation, and confers mucosal protection in the intestine (1). It has also been found to enhance T cell polarization toward Th2, promote B cell IgG production, increase osteoclast bone absorption, protect endothelial cells from oxidative stress, and regulate epithelial proliferation and apoptosis (1). IL-11 synergizes with several other cytokines to produce these effects, and its effects overlap with those of IL-6 (1). IL-11 receptor activation requires formation of a complex of two IL-11 molecules with two molecules of the ligand-binding IL-11 R alpha subunit and two molecules of the ubiquitously expressed cell signaling beta subunit, gp130 (5). A soluble form of IL-11 R alpha can bind IL-11 and either form a signaling complex with gp130 on the cell surface, or inhibit cell surface IL-11 R alpha /gp130 signaling (6-8).

Bio-Activity: Measured in a cell proliferation assay using TF-1 Human erythroleukemic cells. The ED50 for this effect is 2.64-10.56 ng/mL, corresponding to a specific activity of 9.47×10^4 ~3.79×10^5 units/mg.

Source: E. coli

Tag: No tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details