Skip to product information
1 of 1

ABclonal

Recombinant Mouse IL-12/IL-12A&IL-12B Protein - RP01691

Recombinant Mouse IL-12/IL-12A&IL-12B Protein - RP01691

Regular price $168.00 CAD
Regular price Sale price $168.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse IL-12/IL-12A&IL-12B Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01691-10, RP01691-20, RP01691-50, RP01691-100

Citations, Manuals and MSDS Available upon request.

Description: Active Recombinant Mouse IL-12/IL-12A&IL-12B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg23-Ala215&Met23-Ser335) of Mouse IL-12A&IL-12B (Accession #P43431&P43432) fused with and a 6×His tag at the C-terminus(IL-12).

Alternate Names: p35; IL12; Il-12a; IL-12p35&p40; Il-12b; Il12p40; Il-12p40, IL-12&Il12b; IL-12 p70 (IL12A&IL12B)

SWISS: P43431&P43432

GeneID: 16159&16160

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 95 % as determined by HPLC.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Interleukin 12 (IL-12) is a pleiotropic cytokine that plays an essential role in Th1-type immune response against cancer, a condition where cells in a particular part of the body grow and reproduce uncontrollably.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA.Immobilized Mouse IL-12A&IL-12B (Catalog: RP01691) at 5 μg/mL (100 μL/well) can bind Human IL12RB1 with a linear range of 0.001-3.3 ng/mL.|2.Measured in a cell proliferation assay using IL2-activated mouse splenocytes. The ED50 for this effect is 0.01- 0.03 ng/mL, corresponding to a specific activity of 3.3×10^7~ 1× 10 ^8 units/mg.|3.Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED50 for this effect is 7.3-29.2 ng/mL, corresponding to a specific activity of 3.4×10^4 ~1.4×10^5 units/mg.

Source: HEK293 cells

Tag: C-His(IL-12a)&No tag(IL-12b)

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA&MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details