Skip to product information
1 of 1

ABclonal

Recombinant Mouse IL-12B/IL-12 p40 Protein - RP01696

Recombinant Mouse IL-12B/IL-12 p40 Protein - RP01696

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse IL-12B/IL-12 p40 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01696-10, RP01696-20, RP01696-50, RP01696-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse IL-12B/IL-12 p40 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met23-Ser335) of mouse IL-12B (Accession #NP_001152896.1) fused with no additional amino acid.

Alternate Names: p40; Il-12b; Il12p40; Il-12p40; IL12B

SWISS: P43432

GeneID: 16160

Species: Mouse

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Subunit beta of interleukin 12 (also known as natural killer cell stimulatory factor 2, or cytotoxic lymphocyte maturation factor 2, p40) (IL12B) is a subunit of human interleukin 12. IL12B/IL-12B is a cytokine that acts on T and natural killer cells and has a broad array of biological activities.IL12B/IL-12B is expressed by activated macrophages that serve as an essential inducer of Th1 cells development. This cytokine is important for sustaining a sufficient number of memory/effector Th1 cells to mediate long-term protection to an intracellular pathogen.

Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Mouse IL12B (Catalog: RP01696) at 10 μg/mL (100 μL/well) can bind Human IL12RB1 with a linear range of 0.02-51 ng/mL.

Source: HEK293 cells

Tag: NO-tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details