ABclonal
Recombinant Mouse IL-13 Protein - RP01596
Recombinant Mouse IL-13 Protein - RP01596
Couldn't load pickup availability
Recombinant Mouse IL-13 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01596-10, RP01596-20, RP01596-50, RP01596-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IL-13 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser26-Phe131) of mouse IL-13 (Accession #NP_032381.1) fused with and a 6×His tag at the C-terminus.
Alternate Names: Interleukin-13, IL-13, T-Cell Activation Protein P600, Il13, Il-13, IL13, Interleukin-13, IL-13, T-Cell Activation Protein P600, Il13, Il-13, IL13
SWISS: P20109
GeneID: 16163
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Mouse interleukin 13 (mIL-13) is a pleiotropic cytokine produced by activated Th2 cells. IL-13 induces B cell proliferation and immunoglobin production. It contains a four helical bundle with two internal disulfide bonds. Mouse IL13 shares 58% sequence identity with human protein and exhibits cross-species activity. IL13 signals via receptor IL13R (type2, IL4R) and activates STAT-6. IL13 initially binds IL-13Rα1 with low affinity and triggers association of IL4R α , generating a high affinity heterodimeric receptor IL13R and eliciting downstream signals. IL13 also binds IL-13Rα2 with high affinity, which plays a role in a negative feedback system of IL13 signaling. IL13 is an important mediator of allergic inflammation and disease.
Bio-Activity: Measured in a cell proliferation assay using TF-1 Mouse erythroleukemic cells.The ED50 for this effect is 5.4-21.4 ng/mL, corresponding to a specific activity of 4.68×10^4 ~1.85×10^5 units/mg.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
