Skip to product information
1 of 1

ABclonal

Recombinant Mouse IL-15 Protein - RP01676

Recombinant Mouse IL-15 Protein - RP01676

Regular price $308.00 CAD
Regular price Sale price $308.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse IL-15 Protein

Sizes: 20ug, 50ug, 100ug

Catalogue Numbers: RP01676-20, RP01676-50, RP01676-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse IL-15 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Asn49-Ser162) of mouse IL-15 (Accession #NP_001241676.1) fused with and a 6×His tag at the C-terminus.

Alternate Names: Il15, Interleukin-15, IL-15

SWISS: P48346

GeneID: 16168

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Interleukin 15 (IL-15 ) is a cytokine that regulates T and natural killer cell activation and proliferation. IL-15 induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. In mouse, studies suggest that IL-15 may increase the expression of apoptosis inhibitor Bcl-xL, possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. IL-15 plays an important role in the growth and differentiation of T and B lymphocytes, natural killer cells, macrophages, and monocytes as well as activation of a number of important intracellular signaling molecules.

Bio-Activity: 1.Measured in a cell proliferation assay using HT-2 mouse T cells. The ED50 for this effect is 15-58 ng/mL, corresponding to a specific activity of 1.72×10^4 -6.67×10^4 units/mg.2.Measured in a cell proliferation assay using CTLL‑2 mouse T cells. The ED50 for this effect is 8.1‑32.4ng/mL,corresponding to a specific activity of 3.09×104~1.23×105units/mg.

Source: E. coli

Tag: C-6His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details