Skip to product information
1 of 1

ABclonal

Recombinant Mouse IL-15RA/CD215 Protein - RP01373

Recombinant Mouse IL-15RA/CD215 Protein - RP01373

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse IL-15RA/CD215 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01373-10, RP01373-20, RP01373-50, RP01373-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse IL-15RA/CD215 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly33-Lys205) of mouse IL15RA/CD215 (Accession #NP_032384.1) fused with a Fc, 6×His tag at the C-terminus.

Alternate Names: IL-15RA, CD215, AA690181, IL15RA

SWISS: Q60819-1

GeneID: 16169

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Mouse interleukin-15 receptor subunit alpha, also known as Il15ra, is a high-affinity receptor for interleukin-15.Il15ra associates as a heterotrimer with the IL-2 receptor beta and gamma subunits (Common gamma chain, orgamma c) to initiate signal transduction. It can signal both in cis and trans where IL15R from one subset of cellspresents IL15 to neighboring IL2RG-expressing cells. Il15ra is expressed in special cells including a wide varietyof Tand B cells and non-lymphoid cells. Human Il15ra shares 45% amino acid sequence homology with themouse form of the receptor. Eight isoforms of IL-15 R alpha mRNA have been identified, resulting fromalternative splicing events involving different exons.

Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human IL15 at 1 μg/mL (100 μL/well) can bind Mouse IL15RA with a linear range of 0.3-77 ng/mL.

Source: HEK293 cells

Tag: C-hFc&His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details