WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse IL-17A/CTLA-8 Protein - RP01460

Recombinant Mouse IL-17A/CTLA-8 Protein - RP01460

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Mouse IL-17A/CTLA-8 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01460-10, RP01460-20, RP01460-50, RP01460-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse IL-17A/CTLA-8 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala26-Ala158) of mouse IL-17A/CTLA-8 (Accession #NP_034682.1.) fused with a 6×His tag at the C-terminus.

Alternate Names: Il17, Ctla8, IL-17, Ctla-8, IL17A, IL-17A

SWISS: Q62386-1

GeneID: 16171

Species: Mouse

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: IL17, also known as IL17a, is a cytokine that belongs to the IL-17 family. Cytokines are proteinaceous signaling compounds that are major mediators of the immune response. They control many different cellular functions including proliferation, differentiation, and cell survival/apoptosis but are also involved in several pathophysiological processes including viral infections and autoimmune diseases. Cytokines are synthesized under various stimuli by a variety of cells of both the innate (monocytes, macrophages, dendritic cells) and adaptive (T- and B-cells) immune systems. The IL-17 family of cytokines includes six members, IL-17/IL-17A, IL-17B, IL-17C, IL-17D, IL-17E/IL-25, and IL-17F, which are produced by multiple cell types. IL-17 regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of IL-17 are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis, and multiple sclerosis.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-17A/CTLA-8 at 2 μg/mL (100 μL/well) can bind Mouse IL-17RA/CD217 with a linear range of 0.1-26 ng/mL.Measured by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells in the presense of 2 ng/mL TNFα(Catalog: RP01071).The ED50 for this effect is 0.26-1.04 ng/mL, corresponding to a specific activity of 9.62×10^5 ~3.85×10^6 units/mg.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only