Skip to product information
1 of 1

Elabscience

Recombinant Mouse IL-17D protein(N-His) - PKSM041506

Recombinant Mouse IL-17D protein(N-His) - PKSM041506

Regular price $1,034.60 CAD
Regular price Sale price $1,034.60 CAD
Sale Sold out
Quantity

Get a quote

Recombinant Mouse IL-17D protein(N-His)

Size: 100μg

Catalogue Number: PKSM041506-100

Citations, Manuals and MSDS Available upon request.

Abbreviation: IL-17D

Target Symptom: Flt3L

Target Species: Mouse

Expression Host: E.coli

Fusion Tag: N-His

UNIProt ID: Q8K4C4

Accession: Q8K4C4

Background: The Interleukin-17 family proteins, comprising six members (IL-17, IL-17B through IL-17F), are secreted, structurally related proteins that share a conserved cysteine-knot fold near the C-terminus, but have considerable sequence divergence at the N-terminus. IL-17 family proteins are proinflammatory cytokines that induce local cytokine production and are involved in the regulation of immune functions. Among IL-17 family members, IL-17D is most closely related to IL-17B, sharing 27% aa sequence homology. IL-17D is expressed preferentially in skeletal muscle, heart, adipose tissue, lung, pancreas, and nervous system. Like other IL-17 family members, IL-17D modulates immune responses indirectly by stimulating the production of myeloid growth factors and chemokines including IL-6, IL-8, and GM-CSF. IL-17D has also been shown to suppress the proliferation of myeloid progenitors in colony formation assays.

Sequence: MLGTLVWMLLVGFLLALAPGRAAGALRTGRRPARPRDCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRAADRRFRPPTNLRSVSPWAYRISYDPARFPRYLPEAYCLCRGCLTGLYGEEDFRFRSTPVFSPAVVLRRTAACAGGRSVYAEHYITIPVGCTCVPEPDKSADSANSSMDKLLLGPADRPAGR

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5.
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Reconstitution: Please refer to the printed manual for detailed information.

Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.

Calculated MW: 23.22 kDa

Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Shipping: This product is provided as lyophilized powder which is shipped with ice packs.

Research Use Only

View full details