ABclonal
Recombinant Mouse IL-18 Protein - RP02521
Recombinant Mouse IL-18 Protein - RP02521
Regular price
$210.00 CAD
Regular price
Sale price
$210.00 CAD
Quantity
Couldn't load pickup availability
Recombinant Mouse IL-18 Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP02521-10, RP02521-20, RP02521-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IL-18 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence of Mouse IL-18 fused with His tag at the C-terminus
Alternate Names: Ig, Il-, Igif, Il-18, IL18
SWISS: P70380
GeneID: 16173
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interleukin-18 (L-18) is a cytokine that belongs to the IL-1 superfamily and is produced by macrophages and other cells. IL-18 works by binding to the interleukin-18 receptor, and together with IL-12 it induces cell-mediated immunity following infection with microbial products like lipopolysaccharide (LPS). After stimulation with IL-18, natural killer (NK) cells and certain T cells release another important cytokine called interferon-γ (IFN-γ) or type II interferon that plays an important role in activating the macrophages or other cells. The combination of this cytokine and IL12 has been shown to inhibit IL-4 dependent IgE and IgG1 production, and enhance IgG2a production in B cells. IL-18 binding protein (IL18BP) can specifically interact with this cytokine, and thus negatively regulate its biological activity.
Bio-Activity: Measured by its ability to induce IFN-gamma secretion by KG1 human acute myelogenous leukemia cells in the presence of TNF-alpha(Catalog: RP00001). The ED50 for this effect is 42.93-171.72 ng/mL, corresponding to a specific activity of 0.58×10^4 ~2.3×10^5 units/mg.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0.
Antigen Sequence: NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
View full details
