Recombinant Mouse IL-19 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01876-10, RP01876-20, RP01876-50, RP01876-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IL19 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu25-Ala176) of Mouse IL19 (Accession #NP_001009940.1) fused with a hFc tag at the C-terminus.
Alternate Names: Interleukin-19, IL-19, Il19
SWISS: Q8CJ70
GeneID: 329244
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: IL-19 shares 21% amino acid identity with IL-10. The exon/intron structure of IL-19 is similar to that of the human IL-10 gene, comprising five exons and four introns within the coding region of the IL-19 cDNA. IL-19 does not bind or signal through the canonical IL-10 receptor complex. IL-19 functions through a receptor complex composed of IL-20Ra and IL20Rb that is also utilized by IL-20 and IL-24. IL19 has been shown to enhance the production of Th2 cytokines in Tcells and to be elevated in asthma patients. Furthermore, it induces IL-6, IL-8 and IL-10 expression in monocytes. Additionally, it has been implicated in a range of diseases and disorders, including aging, Type-I diabetes, endotoxic shock, periodontal disease, vascular disease and rheumatoid arthritis.
Source: HEK293 cells
Tag: C-hFc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: LRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only