Skip to product information
1 of 1

ABclonal

Recombinant Mouse IL-1Ra/IL-1F3/IL-1RN Protein - RP00666

Recombinant Mouse IL-1Ra/IL-1F3/IL-1RN Protein - RP00666

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse IL-1Ra/IL-1F3/IL-1RN Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP00666-10, RP00666-20, RP00666-50, RP00666-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse IL-1Ra/IL-1F3/IL-1RN Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg27-Gln178) of mouse IL-1Ra/IL-1F3/IL-1RN (Accession #P25085) fused with an initial Met at the N-terminus.

Alternate Names: IL-1ra, F630041P17Rik, IL1RN

SWISS: P25085

GeneID: 16181

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Interleukin-1 receptor antagonist protein (Il1rn), also known as IL-1ra, IRAP or IL1 inhibitor, is a member of theinterleukin 1 cytokine family. This protein inhibits the activities of interleukin 1 alpha (IL1A) and interleukin 1beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. The mouseIl1rn gene encodes a 178 amino acids (aa) protein with a 26 aa signal peptide. Mouse Il1rn protein shares 26%and 19% identity with its homologues IL-1 beta and IL-1 alpha, respectively. Il1rn can Inhibits the activity ofinterleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP forsignaling, but has no interleukin-1 like activity. Recently, an recombinant human Il1rn protein is used in thetreatment of rheumatoid arthritis, an autoimmune disease in which IL-1 plays a key role.

Bio-Activity: Measured by its ability to inhibit IL-1 alpha-dependent proliferation in D10.G4.1 mouse helper T cells. The ED50 for this effect is 2.47-9.86 ng/mL in the presence of 3ng/mL of recombinant human IL-1 alpha(Catalog: RP00098), corresponding to a specific activity of 1.01×10^5 ~4.05×10^5 units/mg.

Source: E. coli

Tag: No tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: RPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details