ABclonal
Recombinant Mouse IL-20 Protein - RP01951
Recombinant Mouse IL-20 Protein - RP01951
Couldn't load pickup availability
Recombinant Mouse IL-20 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01951-10, RP01951-20, RP01951-50, RP01951-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IL-20 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu25-Leu176)of Mouse IL-20 (Accession #Q9JKV9) fused with a His tag at the N-terminus.
Alternate Names: Il20, Zcyto10, Interleukin-20, IL-20, Cytokine Zcyto10
SWISS: Q9JKV9
GeneID: 58181
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Mouse Interleukin 20 (IL-20) was identified by searching sequence databases for translated sequences with a signal sequence and amphipathic helices found in helical cytokines. Based on the human molecule, mouse IL-20 was discovered in a skin library. Mouse IL-20 is synthesized as a 176 amino acid (aa) precursor that contains a 24 aa signal sequence and a 152 aa mature segment. There are no N-linked glycosylation sites and it is doubtful that the native molecule is glycosylated. Although IL-20 is a distant member of the IL-10 family, it functions as a monomer. IL-20 shares less than 40% aa sequence identity with other IL-10 family members. Mouse and human IL-20 are 77% aa identical in the mature segment. IL-20 production has been found in skin and trachea. In particular, activated keratinocytes and, possibly, monocytes are reported to express IL-20. There are two heterodimeric receptor complexes for IL-20. The first complex is composed of IL-20 R alpha and IL‑20 R beta. The second complex is composed of IL-22 R and IL‑20 R beta. Whereas the IL-22 R/IL-20 R beta complex is shared with IL-24/mda-7, the IL‑20 R alpha /IL‑20 R beta complex is shared with both IL-19 and IL-24. Little is known about the function of IL-20. It is reported to induce the proliferation of multipotential hematopoietic progenitor cells, direct the differentiation and expansion of keratinocytes, and promote the release of proinflammatory mediators in keratinocytes and other IL-20 receptor expressing cells.
Source: HEK293 cells
Tag: N-His
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mM PB,500mM NaCl, pH 8.0.
Antigen Sequence: LKTLHLGSCVITANLQAIQKEFSEIRDSVQAEDTNIDIRILRTTESLKDIKSLDRCCFLRHLVRFYLDRVFKVYQTPDHHTLRKISSLANSFLIIKKDLSVCHSHMACHCGEEAMEKYNQILSHFIELELQAAVVKALGELGILLRWMEEML
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
