ABclonal
Recombinant Mouse IL-21 Protein - RP02775S
Recombinant Mouse IL-21 Protein - RP02775S
Couldn't load pickup availability
Recombinant Mouse IL-21 Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP02775S-10, RP02775S-20, RP02775S-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IL-21 Protein is produced by CHO Cells expression system. The target protein is expressed with sequence (Ser21-Ser146) of Mouse IL-21 (Accession #NP_068554.1) fused with a His tag at the C-terminus.
Alternate Names: Interleukin-21, IL-21, Il21
SWISS: Q9ES17
GeneID: 60505
Species: Mouse
Purity: ≥ 85 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: IL21 belongs to the IL-15/IL-21 family. It is a cytokine with immunoregulatory activity. Cytokines are proteinaceous signaling compounds that are major mediators of the immune response. They control many different cellular functions including proliferation, differentiation, and cell survival/apoptosis but are also involved in several pathophysiological processes including viral infections and autoimmune diseases. Cytokines are synthesized under various stimuli by a variety of cells of both the innate (monocytes, macrophages, dendritic cells) and adaptive (T- and B-cells) immune systems. IL21 is expressed in activated CD4-positive T-cells but not in CD8-positive T-cells, B-cells, or monocytes. It may promote the transition between innate and adaptive immunity. IL-21 has been tried as a therapy for alleviating allergic responses. It can significantly decrease pro-inflammatory cytokines produced by T cells in addition to decreasing IgE levels in a mouse model for rhinitis (nasal passage inflammation).
Source: CHO Cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: SPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
