Skip to product information
1 of 1

ABclonal

Recombinant Mouse IL-22 Protein - RP01617

Recombinant Mouse IL-22 Protein - RP01617

Regular price $252.00 CAD
Regular price Sale price $252.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse IL-22 Protein

Sizes: 20ug, 50ug

Catalogue Number: RP01617-20, RP01617-50

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse IL-22 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu34-Val179) of mouse IL-22 (Accession #NP_058667.1) fused with and a hFc tag at the C-terminus.

Alternate Names: Interleukin-22; IL-22; Cytokine Zcyto18; IL-TIF; IL-D110; TIFa; TIFIL-23; ZCYTO18, IL22

SWISS: Q9JJY9

GeneID: 50929

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The cytokine interleukin-22 (IL-22) is a critical regulator of epithelial homeostasis. It has been implicated in multiple aspects of epithelial barrier function, including regulation of epithelial cell growth and permeability, production of mucus and antimicrobial proteins (AMPs), and complement production.

Bio-Activity: Measured by its ability to induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells. The ED50 for this effect is 150-600 ng/mL.

Source: HEK293 cells

Tag: C-hFC

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details