ABclonal
Recombinant Mouse IL-22 Protein - RP01617
Recombinant Mouse IL-22 Protein - RP01617
Couldn't load pickup availability
Recombinant Mouse IL-22 Protein
Sizes: 20ug, 50ug
Catalogue Number: RP01617-20, RP01617-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IL-22 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu34-Val179) of mouse IL-22 (Accession #NP_058667.1) fused with and a hFc tag at the C-terminus.
Alternate Names: Interleukin-22; IL-22; Cytokine Zcyto18; IL-TIF; IL-D110; TIFa; TIFIL-23; ZCYTO18, IL22
SWISS: Q9JJY9
GeneID: 50929
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The cytokine interleukin-22 (IL-22) is a critical regulator of epithelial homeostasis. It has been implicated in multiple aspects of epithelial barrier function, including regulation of epithelial cell growth and permeability, production of mucus and antimicrobial proteins (AMPs), and complement production.
Bio-Activity: Measured by its ability to induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells. The ED50 for this effect is 150-600 ng/mL.
Source: HEK293 cells
Tag: C-hFC
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
