WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse IL-23/IL-12B&IL-23A Protein - RP02928S

Recombinant Mouse IL-23/IL-12B&IL-23A Protein - RP02928S

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Mouse IL-23/IL-12B&IL-23A Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP02928S-10, RP02928S-20, RP02928S-50, RP02928S-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse IL-23/IL-12B&IL-23A Protein is produced by HEK293 expression system. The target protein is expressed with sequence (N-His(IL-23a)&No tag(IL-12b)) of mouse Met23-Ser335&Ala21-Ala196 (Accession #) fused with a 6×His tag at the N-terminus(IL23A).

Alternate Names: p40; Il-12b; Il12p40; Il-12p40; IL12B; p19; IL-23; il23A

SWISS: P43432&Q9EQ14

GeneID: 16160&83430

Species: Mouse

Purity: ≥ 90% as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Interleukin 23 (IL-23) is a heterodimeric cytokine composed of two disulfide-linked subunits, a p19 subunit that is unique to IL-23, and a p40 subunit that is shared with IL-12 (1-5). The p19 subunit has homology to the p35 subunit of IL-12, as well as to other single chain cytokines such as IL-6 and IL-11. The p40 subunit is homologous to the extracellular domains of the hematopoietic cytokine receptors. Mouse p19 cDNA encodes a 196 amino acid residue (aa) precursor protein with a putative 19 aa signal peptide and 177 aa mature protein. Human and mouse p19 share 70% aa sequence identity. Although p19 is expressed by activated macrophages, dendritic cells, T?cells, and endothelial cells, only activated macrophages and dendritic cells express p40 concurrently to produce IL-23. The functional IL-23 receptor complex consists of two receptor subunits, the IL-12 receptor beta 1 subunit (IL-12 R beta 1) and the IL-23-specific receptor subunit (IL-23 R). IL-23 has biological activities that are similar to, but distinct from IL-12. Both IL-12 and IL-23 induce proliferation and IFN-gamma production by human T?cells. While IL-12 acts on both na?ve and memory human Tnbsp; cells, the effects of IL-23 is restricted to memory Tcells. In mouse, IL-23 but not IL-12, has also been shown to induce memory T cells to secret IL-17, a potent proinflammatory cytokine. IL-12 and IL-23 can induce IL-12 production from mouse splenic DC of both the CD8- and CD8+ subtypes, however only IL-23 can act directly on CD8+ DC to mediate immunogenic presentation of poorly immunogenic tumor/self peptide.

Bio-Activity: Measured by its ability to induce IL-17 secretion by mouse splenocytes. The ED50 for this effect is 29.1-116.4 pg/mL, corresponding to a specific activity of 8.59×10^6 ~3.44×10^7 units/mg.

Source: HEK293 cells

Tag: N-His(IL-23a)&No tag(IL-12b)

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS&AVPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only