WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse IL-24 protein(N-His)(active) - PKSM041470
Recombinant Mouse IL-24 protein(N-His)(active) - PKSM041470

Recombinant Mouse IL-24 protein(N-His)(active) - PKSM041470

Regular price
$348.60
Regular price
Sale price
$348.60
Unit price
per 
Availability
Sold out

Recombinant Mouse IL-24 protein(N-His)(active)

Sizes: 20μg, 100μg

Catalogue Numbers: PKSM041470-20, PKSM041470-100

Citations, Manuals and MSDS Available upon request.

Abbreviation: IL-24

Target Symptom: MCGF (Mast Cell Growth Factor); Multi-CSF; HCGF; P-cell stimulation factor; Interleukin-3b

Target Species: Mouse

Expression Host: E.coli

Application: Cell culture

Fusion Tag: N-His

UNIProt ID: Q925S4

Accession: Q925S4

Background: Multifunctional cytokine mainly produced by T-cells that plays a regulatory role in immune response, tissue homeostasis, host defense, and oncogenesis. Possesses antiviral functions and induces the type I intereferon response during influenza infection. Signals through two receptor complexes IL20RA/IL20RB or IL20RB/IL22RA1. In turn, stimulates the JAK1-STAT3 and MAPK pathways and promotes the secretion of pro-inflammatory mediators including IL8 and MMP1. Intracellularly, maintains endoplasmic reticulum homeostasis by restricting the eIF2alpha-CHOP pathway-mediated stress signal. In addition, acts as a quality control mechanism for the ubiquitin proteasome system by alerting the cell to proteasome dysfunction through activation of PKR/EIF2AK2.

Activity: Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta.
The ED50 for this effect is < 0.3 ng/mL.

Sequence: MSWGLQILPCLSLILLLWNQVPGLEGQEFRSGSCQVTGVVLPELWEAFWTVKNTVQTQDDITSIRLLKPQVLRNVSGAESCYLAHSLLKFYLNTVFKNYHSKIAKFKVLRSFSTLANNFIVIMSQLQPSKDNSMLPISESAHQRFLLFRRAFKQLDTEVALVKAFGEVDILLTWMQKFYHL

Purity: > 95 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Reconstitution: Please refer to the printed manual for detailed information.

Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.

Calculated MW: 21.64 kDa

Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Shipping: This product is provided as lyophilized powder which is shipped with ice packs.

Research Use Only