ABclonal
Recombinant Mouse IL-27/IL-27A&IL-27B Protein - RP00772
Recombinant Mouse IL-27/IL-27A&IL-27B Protein - RP00772
Couldn't load pickup availability
Recombinant Mouse IL-27/IL-27A&IL-27B Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP00772-10, RP00772-20, RP00772-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IL-27 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Tyr19-Pro228&Phe29-Ser234) of mouse IL-27 (Accession #O35228&Q8K3I6) fused with a 6×His tag at the C-terminus.
Alternate Names: Interleukin-27 subunit alpha, IL27-A, p28, Il27, Il27a, Interleukin-27 subunit beta, Ebi3, IL-27 subunitbeta, IL-27B, Il27b
SWISS: O35228&Q8K3I6
GeneID: 246779&50498
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: IL-27 is a heterodimeric cytokine which belongs to the IL-6/IL-12 family of long type I cytokines. It is expressed onmonocytes, endothelial cells and dendritic cells. IL-27 is an early product of activated antigen-presenting cells and drivesrapid clonal expansion of naive CD4(+) T cells and plays a role in the early regulation of Th1 cells initiation which drivesefficient adaptive immune response. IL-27 has an antiproliferative activity on melanomas through WSX-1/STAT1 signaling.Thus, IL-27 protein may be an attractive candidate as an antitumor agent applicable to cancer immunotherapy. IL-27reveals to be a potent inhibitor of TH17 cell development and of IL-17 production. Indeed IL27 alone is also able to inhibitthe production of IL17 by CD4 and CD8 T-cells. IL-27 has also an effect on cytokine production. It suppressesproinflammatory cytokine production such as IL2, IL4, IL5 and IL6 and activates suppressors of cytokine signaling such asSOCS1 and SOCS3. Apart from suppression of cytokine production, IL-27 also antagonizes the effects of some cytokinessuch as IL6 through direct effects on T-cells. Another important role of IL-27 is its antitumor activity as well as itsantiangiogenic activity with activation of production of antiangiogenic chemokines such as IP-10 and MIG.
Bio-Activity: Measured in a cell proliferation assay using TF-1 Human erythroleukemic cells. The ED50 for this effect is 0.24-0.94 ng/mL, corresponding to a specific activity of 1.06×10^6 ~4.17×10^6 units/mg.
Source: HEK293 cells
Tag: C-6×His
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4. Contact us for customized product form or formulation.
Antigen Sequence: YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
