Skip to product information
1 of 2

Elabscience

Recombinant Mouse IL-28B protein(N-His)(active) - PKSM041474

Recombinant Mouse IL-28B protein(N-His)(active) - PKSM041474

Regular price $348.60 CAD
Regular price Sale price $348.60 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse IL-28B protein(N-His)(active)

Sizes: 20μg, 100μg

Catalogue Numbers: PKSM041474-20, PKSM041474-100

Citations, Manuals and MSDS Available upon request.

Abbreviation: IL-28B

Target Symptom: Interleukin-12 subunit alpha; IL-12 subunit p35; IL-12A; Cytotoxic Lymphocyte Maturation Factor 35 kDa

Target Species: Mouse

Expression Host: E.coli

Application: Cell culture

Fusion Tag: N-His

UNIProt ID: Q8CGK6

Accession: Q8CGK6

Background: Interleukin-28B; also known as Cytokine Zcyto22; Interferon lambda-3; Interferon lambda-4; IFNL3; IFNL4; ZCYTO22 and IL28B; is a secreted cytokine which belongs to the IL-28/IL-29 family. IL-28 has also been shown to play a role in the adaptive immune response. IL28B has immunomodulatory activity and up-regulates MHC class I antigen expression. IL28B displays potent antiviral activity and antitumor activity. In addition; IL28B is a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway.

Activity: Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is < 20 ng/mL.

Sequence: MLLLLLPLLLAAVLTRTQADPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKGAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENINDSALTTILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFQLLLRDLKCVASGDQCV

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Reconstitution: Please refer to the printed manual for detailed information.

Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.

Calculated MW: 22.49 kDa

Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Shipping: This product is provided as lyophilized powder which is shipped with ice packs.

Research Use Only

View full details