WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse IL-3 Protein - RP01386

Recombinant Mouse IL-3 Protein - RP01386

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Mouse IL-3 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01386-10, RP01386-20, RP01386-50, RP01386-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse IL-3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Cys166) of mouse IL3 (Accession #NP_034686.2.) fused with a 6×His tag at the C-terminus.

Alternate Names: BPA, Csfmu, HCGF, IL-3, MCGF, PSF, IL3

SWISS: P01586

GeneID: 16187

Species: Mouse

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: IL3 (interleukin 3), also known as IL-3, is a potent growth-promoting cytokine that belongs to the IL-3 family. IL3/IL-3 also belongs to the group of interleukins. Interleukins are produced by a wide variety of body cells. The function of the immune system depends in a large part on interleukins, and rare deficiencies of a number of them have been described, all featuring autoimmune diseases or immune deficiency. The majority of interleukins are synthesized by helper CD4+ T lymphocytes, as well as through monocytes, macrophages, and endothelial cells. They promote the development and differentiation of T, B, and hematopoietic cells. IL3/IL-3 is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation, and apoptosis. IL3/IL-3 has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders.

Bio-Activity: Measured in a cell proliferation assay using BaF3 mouse pro-B cells. The ED50 for this effect is 1.5-6 pg/mL, corresponding to a specific activity of 1.67 × 10^8 ~6.67× 10^8 units/mg.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: MVLASSTTSIHTMLLLLLMLFHLGLQASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only