ABclonal
Recombinant Mouse IL-4 Protein - RP01161
Recombinant Mouse IL-4 Protein - RP01161
Couldn't load pickup availability
Recombinant Mouse IL-4 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01161-10, RP01161-20, RP01161-50, RP01161-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IL-4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His23-Ser140) of mouse IL-4 (Accession #NP_067258.1) fused with a 6×His tag at the C-terminus.
Alternate Names: Il-4, BSF-1, IL4
SWISS: P07750
GeneID: 16189
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 95 % as determined by HPLC.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interleukin-4, also known as IL4, is a secreted protein that belongs to the IL-4 / IL-13 family. Interleukin-4 / IL4 has many biological roles, including the stimulation of activated B-cell and T-cell proliferation. It enhances both secretion and cell surface expression of IgE and IgG1. Interleukin-4 / IL4 also regulates the expression of the low-affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Interleukin-4 is essential for the switching of B cells to IgE antibody production and the maturation of T helper (Th) cells toward the Th2 phenotype.
Bio-Activity: 1.Measured in a cell proliferation assay using MC/9 2 mouse mast cells. The ED50 for this effect is 2.8-11.3 pg/mL, corresponding to a specific activity of 8.85×10^7~3.57×10^8 units/mg. 2.Measured in a cell proliferation assay using HT-2 mouse T cells. The ED50 for this effect is 1.18-4.70 ng/mL, corresponding to a specific activity of 2.13×10^5 ~8.51×10^6 units/mg.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
