Skip to product information
1 of 1

ABclonal

Recombinant Mouse IL-4R alpha/CD124 Protein - RP01680

Recombinant Mouse IL-4R alpha/CD124 Protein - RP01680

Regular price $182.00 CAD
Regular price Sale price $182.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse IL-4R alpha/CD124 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01680-10, RP01680-20, RP01680-50, RP01680-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse IL-4R alpha/CD124 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile 26 - Arg 233) of mouse IL4R (Accession #NP_001008700.1) fused with and a 6×His tag at the C-terminus.

Alternate Names: Il4r; CD124; IL-4R

SWISS: P16382

GeneID: 16190

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: CD124, also known as the interleukin 4 receptor (IL4R), is a typeⅠ transmembrane protein that can regulate IgE antibody production in B cells through binding to interleukin 4 and interleukin 13 and promote differentiation of Th2 cells through binding to interleukin 4. The membrane-bound form of CD124 can be hydrolyzed to a soluble form which can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells.

Bio-Activity: Measured by its ability to inhibit the mIL-4-dependent proliferation of HT-2 mouse T cells. The ED50 for this effect is 0.5-2 μg/mL in the presence of 5 ng/mL of recombinant mouse IL-4(Catalog: RP01161).

Source: HEK293 cells

Tag: C-6His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: IKVLGEPTCFSDYIRTSTCEWFLDSAVDCSSQLCLHYRLMFFEFSENLTCIPRNSASTVCVCHMEMNRPVQSDRYQMELWAEHRQLWQGSFSPSGNVKPLAPDNLTLHTNVSDEWLLTWNNLYPSNNLLYKDLISMVNISREDNPAEFIVYNVTYKEPRLSFPINILMSGVYYTARVRVRSQILTGTWSEWSPSITWYNHFQLPLIQR

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details