ABclonal
Recombinant Mouse IL-5 Protein - RP01670
Recombinant Mouse IL-5 Protein - RP01670
Couldn't load pickup availability
Recombinant Mouse IL-5 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01670-10, RP01670-20, RP01670-50, RP01670-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IL-5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met21-Gly133) of mouse IL-5 (Accession #NP_034688.1) fused with and a 6×His tag at the C-terminus.
Alternate Names: Il-5; IL5
SWISS: P04401
GeneID: 16191
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interleukin 5 (IL-5) is a member of the interleukin family with a length of 115 amino acids. Interleukins are a group of cytokines (secreted proteins/signaling molecules) that were first seen to be expressed by white blood cells (leukocytes) and has been found in a wide variety of body cells. Interleukin 5 or IL-5 is produced by T helper-2 cells and mast cells. It helps to stimulate B cell growth and increase immunoglobulin secretion and is considered a key mediator in eosinophil activation. Interleukin 5 (IL-5) has long been associated with several allergic diseases, including allergic rhinitis and asthma. Growth in the number of circulating, airway tissue, and induced sputum eosinophils have been observed in patients with these diseases. IL-5 also had something with the terminally differentiated granulocyte eosinophils. IL-5 was originally found as an eosinophil colony-stimulating factor. It has been proved to be a major regulator of eosinophil accumulation in tissues and can modulate eosinophil behavior at every stage from maturation to survival.
Bio-Activity: Measured in a cell proliferation assay using TF-1 Mouse erythroleukemic cells. The ED50 for this effect is 0.12-0.49ng/mL.
Source: HEK293 cells
Tag: C-6His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
