Skip to product information
1 of 2

Elabscience

Recombinant Mouse IL-5 protein(N-His)(active) - PKSM041461

Recombinant Mouse IL-5 protein(N-His)(active) - PKSM041461

Regular price $348.60 CAD
Regular price Sale price $348.60 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse IL-5 protein(N-His)(active) Sizes: 20μg, 100μg Catalogue Numbers: PKSM041461-20, PKSM041461-100 Citations, Manuals and MSDS Available upon request. Abbreviation: IL-5 Target Symptom: Interleukin-5; IL-5; B-cell differentiation factor I; Eosinophil differentiation factor; T-cell replacing factor; TRF; IL5 Target Species: Mouse Expression Host: E.coli Application: Cell culture Fusion Tag: N-His UNIProt ID: P04401 Accession: P04401 Background: Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells. Activity: Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is < 0.2 ng/mL. The specific activity of recombinant mouse IL-5 is > 5 x 106IU/mg. Sequence: MRRMLLHLSVLTLSCVWATAMEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG Purity: > 98 % as determined by reducing SDS-PAGE. Formulation: Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. Reconstitution: Please refer to the printed manual for detailed information. Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method. Calculated MW: 16.24 kDa Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months. Shipping: This product is provided as lyophilized powder which is shipped with ice packs. Research Use Only
View full details