Elabscience
Recombinant Mouse IL-5 protein(N-His)(active) - PKSM041461
Recombinant Mouse IL-5 protein(N-His)(active) - PKSM041461
Regular price
$348.60 CAD
Regular price
Sale price
$348.60 CAD
Quantity
Couldn't load pickup availability
Recombinant Mouse IL-5 protein(N-His)(active)
Sizes: 20μg, 100μg
Catalogue Numbers: PKSM041461-20, PKSM041461-100
Citations, Manuals and MSDS Available upon request.
Abbreviation: IL-5
Target Symptom: Interleukin-5; IL-5; B-cell differentiation factor I; Eosinophil differentiation factor; T-cell replacing factor; TRF; IL5
Target Species: Mouse
Expression Host: E.coli
Application: Cell culture
Fusion Tag: N-His
UNIProt ID: P04401
Accession: P04401
Background: Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells.
Activity: Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is < 0.2 ng/mL. The specific activity of recombinant mouse IL-5 is > 5 x 106IU/mg.
Sequence: MRRMLLHLSVLTLSCVWATAMEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
Purity: > 98 % as determined by reducing SDS-PAGE.
Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Reconstitution: Please refer to the printed manual for detailed information.
Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.
Calculated MW: 16.24 kDa
Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Shipping: This product is provided as lyophilized powder which is shipped with ice packs.
Research Use Only
View full details
