Skip to product information
1 of 1

ABclonal

Recombinant Mouse IL-5RA/CD125 Protein - RP01473

Recombinant Mouse IL-5RA/CD125 Protein - RP01473

Regular price $210.00 CAD
Regular price Sale price $210.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse IL-5RA/CD125 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01473-10, RP01473-20, RP01473-50, RP01473-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse IL-5RA/CD125 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp18-His339) of mouse IL5RA/CD125 (Accession #NP_032396.1) fused with a 6×His tag at the C-terminus.

Alternate Names: Il5r, CD125, CDw125, IL5RA

SWISS: P21183

GeneID: 16192

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Interleukin 5 receptor, alpha (IL5RA) also known as CD125 (Cluster of Differentiation 125) is a subunit of the Interleukin-5 receptor. IL5RA (CD125) is an interleukin 5 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand-specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony-stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL5 depends on the beta subunit. The beta subunit is activated by the ligand binding and is required for the biological activities of IL5. This protein has been found to interact with syndecan binding protein (syntenin), which is required for IL5 mediated activation of the transcription factor SOX4. Six alternatively spliced transcript variants encoding three distinct isoforms have been reported. IL5RA (CD125) is a T-cell-derived cytokine that is particularly important in the development of asthma for the terminal differentiation, activation, and survival of committed eosinophil precursors.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: DLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVGKERKSLVEWH

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only

View full details