ABclonal
Recombinant Mouse IL-5RA/CD125 Protein - RP01473
Recombinant Mouse IL-5RA/CD125 Protein - RP01473
Couldn't load pickup availability
Recombinant Mouse IL-5RA/CD125 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01473-10, RP01473-20, RP01473-50, RP01473-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IL-5RA/CD125 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp18-His339) of mouse IL5RA/CD125 (Accession #NP_032396.1) fused with a 6×His tag at the C-terminus.
Alternate Names: Il5r, CD125, CDw125, IL5RA
SWISS: P21183
GeneID: 16192
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interleukin 5 receptor, alpha (IL5RA) also known as CD125 (Cluster of Differentiation 125) is a subunit of the Interleukin-5 receptor. IL5RA (CD125) is an interleukin 5 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand-specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony-stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL5 depends on the beta subunit. The beta subunit is activated by the ligand binding and is required for the biological activities of IL5. This protein has been found to interact with syndecan binding protein (syntenin), which is required for IL5 mediated activation of the transcription factor SOX4. Six alternatively spliced transcript variants encoding three distinct isoforms have been reported. IL5RA (CD125) is a T-cell-derived cytokine that is particularly important in the development of asthma for the terminal differentiation, activation, and survival of committed eosinophil precursors.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: DLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVGKERKSLVEWH
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
