Recombinant Mouse IL-6 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01321-10, RP01321-20, RP01321-50, RP01321-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse IL-6 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe25-Thr211) of Mouse IL6 (Accession #NP_112445.1) fused with an 6×His tag at the C-terminus.
Alternate Names: IL6, Interleukin-6, BSF2, HSF, IFNB2, IL6
SWISS: P08505
GeneID: 16193
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interleukin-6 is a multifunctional α-helical cytokine that regulates cell growth and differentiation of various tissues, which is known particularly for its role in the immune response and acute phase reactions.It is secreted by T cells, macrophages , monocytes, fibroblasts,endothelial cells,et.al. to stimulate immune response to trauma, especially burns or other tissue damage leading to inflammation.Interleukin 6 has been shown to interact with interleukin-6 receptor and glycoprotein. IL-6 is relevant to many disease processes such as diabetes,atherosclerosis, depression,Alzheimer's Disease,systemic,lupus erythematosus,prostate cancer and rheumatoid arthritis.
Bio-Activity: Measured in a cell proliferation assay using NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 0.07-0.28 ng/mL, corresponding to a specific activity of 3.57×10^6 ~ 1.43×10^7 units/mg.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: FPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNSDCMNNDDALA ENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYLEYMKNNLKDNKKDKARVLQR DTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVT LRSTRQT
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only