WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse IL-7 Protein - RP01766

Recombinant Mouse IL-7 Protein - RP01766

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Mouse IL-7 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01766-10, RP01766-20, RP01766-50, RP01766-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse IL-7 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu26-Ile154) of mouse IL-7 (Accession #NP_032397.1) fused with a 6×His tag at the C-terminus.

Alternate Names: Il-7; hlb368; A630026I06Rik; il7

SWISS: P10168

GeneID: 16196

Species: Mouse

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: IL7, also known as interleukin 7, is a hematopoietic growth factor that belongs to the IL-7/IL-9 family. It is secreted by stromal cells in the bone marrow and thymus. IL7 stimulates the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. IL7 and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. It is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCR?) during early T cell development. IL7 can be produced locally by intestinal epithelial and epithelial goblet cells and may serve as a regulatory factor for intestinal mucosal lymphocytes.

Bio-Activity: Measured in a cell proliferation assay using murine 2E8 cells. The ED50 for this effect is 1.1-4.2 ng/mL, corresponding to a specific activity of 2.38×10^5 ~9.1×10^5 units/mg.

Source: HEK293 cells

Tag: C-6His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI

Endotoxin: < 0.01 EU/μg of the protein by LAL method

Research Use Only