Elabscience
Recombinant Mouse IL-9 protein(N-His)(active) - PKSM041475
Recombinant Mouse IL-9 protein(N-His)(active) - PKSM041475
Regular price
$348.60 CAD
Regular price
Sale price
$348.60 CAD
Quantity
Couldn't load pickup availability
Recombinant Mouse IL-9 protein(N-His)(active)
Sizes: 20μg, 100μg
Catalogue Numbers: PKSM041475-20, PKSM041475-100
Citations, Manuals and MSDS Available upon request.
Abbreviation: IL-9
Target Symptom: Interleukin-12 subunit beta; IL-12 subunit p40; IL-12B; Cytotoxic Lymphocyte Maturation Factor 40 kDa subunit (CLMF p40); NK cell Stimulating Factor Chain 2
Target Species: Mouse
Expression Host: E.coli
Application: Cell culture
Fusion Tag: N-His
UNIProt ID: P15247
Accession: P15247
Background: Interleukin-9 (IL-9) is a secreted protein that belongs to the IL-7/IL-9 family.Mature mouse IL-9 shares 57% and 74% amino acid sequence identity with human and rat IL-9, respectively. IL-9 supports IL-2 independent and IL-4 independent growth of helper T-cells. IL-9 stimulates cell proliferation and prevents apoptosis. It functions through the IL-9 receptor (IL-9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. IL-9 has been identified as a candidate gene for asthma. IL-9 is a determining factor in the pathogenesis of bronchial hyperresponsiveness.
Activity: Measure by its ability to induce proliferation in MO7e cells. The ED50 for this effect is < 0.2 ng/mL. The specific activity of recombinant mouse IL-9 is > 5 x 106IU/mg.
Sequence: MLVTYILASVLLFSSVLGQRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP
Purity: > 98 % as determined by reducing SDS-PAGE.
Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Reconstitution: Please refer to the printed manual for detailed information.
Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.
Calculated MW: 16.90 kDa
Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Shipping: This product is provided as lyophilized powder which is shipped with ice packs.
Research Use Only
View full details
