ABclonal
Recombinant Mouse L-Selectin/SELL/CD62L Protein - RP02841
Recombinant Mouse L-Selectin/SELL/CD62L Protein - RP02841
Couldn't load pickup availability
Recombinant Mouse L-Selectin/SELL/CD62L Protein
Sizes: 50ug, 100ug
Catalogue Number: RP02841-50, RP02841-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse L-Selectin/SELL/CD62L Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Met1-Asn332) of Mouse L-Selectin/SELL/CD62L (Accession #NP_035476.1) fused with His tag at the C-Terminus.
Alternate Names: IPO5, KPNB3, RANBP5, L-selectin, CD62L
SWISS: P14151
GeneID: 6402
Species: Mouse
Purity: ≥ 90% as determined by reducing SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: L-selectin (CD62L) is a type-I transmembrane glycoprotein and cell adhesion molecule that is expressed on most circulating leukocytes. Since its identification in 1983, L-selectin has been extensively characterized as a tethering/rolling receptor. There is now mounting evidence in the literature to suggest that L-selectin plays a role in regulating monocyte protrusion during transendothelial migration (TEM).
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from 0.22μm filtered solution in PBS (pH 7.4).
Antigen Sequence: DFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYN
Endotoxin: < 0.01 EU/μg of the protein by LAL method.
Research Use Only
