ABclonal
Recombinant Mouse Leukemia inhibitory factor/LIF Protein - RP01416
Recombinant Mouse Leukemia inhibitory factor/LIF Protein - RP01416
Couldn't load pickup availability
Recombinant Mouse Leukemia inhibitory factor/LIF Protein
Sizes: 50ug, 100ug
Catalogue Number: RP01416-50, RP01416-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Leukemia inhibitory factor/LIF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser24-Phe203) of mouse LIF (Accession #NP_032527.1) fused with a 6×His, Avi tag at the C-terminus.
Alternate Names: LIF, CDF, DIA, HILDA, MLPLI, LIF
SWISS: P09056
GeneID: 16878
Species: Mouse
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Leukemia inhibitory factor (LIF) is a pleiotropic glycoprotein belonging to the IL-6 family of cytokines. It is involved in growth promotion and cell differentiation of different types of target cells, influence bone metabolism, cachexia, neural development, embryogenesis, and inflammation. LIF has potent proinflammatory properties, being the inducer of the acute phase protein synthesis and affecting cell recruitment into the area of damage or inflammation. LIF is also one of the cytokines that are capable to regulate the differentiation of embryonic stem cells, hematopoietic, and neuronal cells. LIF binds to the specific LIF receptor (LIFR-α) which forms a heterodimer with a specific subunit common to all members of that family of receptors, the GP130 signal-transducing subunit. This leads to the activation of the JAK/STAT and MAPK cascades. Due to its polyfunctional activities, LIF is involved in the pathogenic events and development of many diseases of various origins.
Bio-Activity: Measured in a cell proliferation assay using TF-1 Human erythroleukemic cells. The ED50 for this effect is 35.675-142.7 ng/mL, corresponding to a specific activity of 7×10^3 ~2.8×10^4 units/mg.
Source: HEK293 cells
Tag: C-His&Avi
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
