ABclonal
Recombinant Mouse LILRB4/ILT-3/CD85k Protein - RP01679
Recombinant Mouse LILRB4/ILT-3/CD85k Protein - RP01679
Couldn't load pickup availability
Recombinant Mouse LILRB4/ILT-3/CD85k Protein
Sizes: 10ug, 20ug, 50ug
Catalogue Numbers: RP01679-10, RP01679-20, RP01679-50
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse LILRB4/ILT-3/CD85k Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly24-Lys238) of mouse LILRB4 (Accession #NP_038560.1) fused with and a 6×His tag at the C-terminus.
Alternate Names: HM18; ILT3; gp49; CD85K; Gp49b; LIR-5; Lilrb4
SWISS: Q64281
GeneID: 14728
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: LILRB4 (Leukocyte Immunoglobulin Like Receptor B4) is a Protein Coding gene. This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. The receptor can also function in antigen capture and presentation. LILRB4 is believed to down-regulate activation signals mediated by non-receptor tyrosine kinase cascades through the recruitment of SHP-1. LILRB4 is associated with the pathological processes of various inflammatory diseases. The LILRB4 is a central inhibitory receptor in Uterine dendritic cells (uDCs) that plays essential immune-regulatory roles at the maternal-fetal interface.
Source: HEK293 cells
Tag: C-6His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQK
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
