Recombinant Mouse Lipocalin-2/NGAL/LCN2 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01064-10, RP01064-20, RP01064-50, RP01064-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Lipocalin-2/NGAL Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln21-Asn200) of mouse Lipocalin-2/NGAL (Accession #NP_032517.1) fused with an 8×His tag at the C-terminus.
Alternate Names: NGAL, LCN2, Lipocalin-2, 24p3, MSFI, LCN2
SWISS: P11672
GeneID: 16819
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: The binding of Fe(DHBA)3 results in the quenching of Trp fluorescence in recombinant mouse Lipocalin-2. Recombinant mouse Lipocalin-2 can bind >1.65 μM of Fe(DHBA)3.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: QDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only