Skip to product information
1 of 1

ABclonal

Recombinant Mouse Lipocalin-2/NGAL/LCN2 Protein - RP01064

Recombinant Mouse Lipocalin-2/NGAL/LCN2 Protein - RP01064

Regular price $182.00 CAD
Regular price Sale price $182.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse Lipocalin-2/NGAL/LCN2 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01064-10, RP01064-20, RP01064-50, RP01064-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse Lipocalin-2/NGAL  Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln21-Asn200) of mouse Lipocalin-2/NGAL  (Accession #NP_032517.1) fused with an 8×His tag at the C-terminus.

Alternate Names: NGAL, LCN2, Lipocalin-2, 24p3, MSFI, LCN2

SWISS: P11672

GeneID: 16819

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: The binding of Fe(DHBA)3 results in the quenching of Trp fluorescence in recombinant mouse Lipocalin-2. Recombinant mouse Lipocalin-2 can bind >1.65 μM of Fe(DHBA)3.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: QDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDN

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details