WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse Mature Beta-nerve growth factor/NGFB Protein - RP00667

Recombinant Mouse Mature Beta-nerve growth factor/NGFB Protein - RP00667

Regular price
$182.00
Regular price
Sale price
$182.00
Unit price
per 
Availability
Sold out

Recombinant Mouse Mature Beta-nerve growth factor/NGFB Protein

Sizes: 10ug, 20ug

Catalogue Number: RP00667-10, RP00667-20

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse Beta-nerve growth factor/NGFB Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser122-Gly241) of Mouse Beta-nerve growth factor/NGFB (Accession #P01139) fused with no tag.

Alternate Names: Beta-Nerve Growth Factor, Beta-NGF, NGF, NGFB

SWISS: P01139

GeneID: 18049

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: NGF is the first member discovered in the Neurotrophin family, which includes brain-derived neurotrophicfactor (BDNF), neurotrophin-3 (NT-3), and neurotrophin-4 (NT-4). These proteins belong to the cysteine-knotfamily of growth factors that assume stable dimeric structures. Mouse beta -NGF is a homodimer of two 120amino acid polypeptides. It shares approximately 90% homology at the amino acid level with human beta -NGFand 95.8% with rat beta -NGF. NGF signaling has been shown to play an important role in neuroprotection andrepair. β-NGF acts as a growth and differentiation factor for B lymphocytes, and enhances B-cell survival. It is apotent neurotrophic factor that signals through its receptor β -NGFR, and plays a crucial role in thedevelopment and preservation of the sensory and sympathetic nervous systems.

Bio-Activity: Measured in a cell proliferation assay using TF-1 Human erythroleukemic cells. The ED50 for this effect is 0.63-2.53 ng/mL, corresponding to a specific activity of 3.95×10^5 ~1.58×10^6 units/mg.

Source: E. coli

Tag: No tag

Formulation: Lyophilized from a 0.2 μm filtered solution of 50mM NaAc,150mM NaCl,pH5.5.

Antigen Sequence: SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only