Recombinant Mouse Mesothelin/MSLN Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01448-10, RP01448-20, RP01448-50, RP01448-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Mesothelin/MSLN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp298-Ser600) of mouse MSLN/Mesothelin (Accession #NP_061345.1) fused with a 6×His tag at the C-terminus.
Alternate Names: MSLN, Mesothelin, MPF, MSLN
SWISS: Q61468-1
GeneID: 56047
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The megakaryocyte potentiating factor belongs to the mesothelin family. This family is comprised of several mammalian pre-pro-megakaryocyte potentiating factor precursor (MPF) or mesothelin proteins. Mesothelin is a glycosylphosphatidylinositol-linked glycoprotein highly expressed in mesothelial cells, mesotheliomas, and ovarian cancer, but the biological function of the protein is not known. Megakaryocyte potentiating factor is highly expressed in mesotheliomas, ovarian cancers, and some squamous cell carcinomas (at protein level). It interacts with MUC16 and potentiates megakaryocyte colony formation in vitro. Megakaryocyte potentiating factor is secreted by several mesothelioma cell lines and is frequently elevated in the blood of patients with mesothelioma. Measurement of this protein may be useful in following the response of mesothelioma to treatment.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Mesothelin/MSLN (Catalog: RP01448) at 2 μg/mL (100 μL/well) can bind Human CA125 (Catalog: RP01444) with a linear range of 0.01-0.72 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only