Skip to product information
1 of 1

ABclonal

Recombinant Mouse Midkine/MDK Protein - RP02865

Recombinant Mouse Midkine/MDK Protein - RP02865

Regular price $196.00 CAD
Regular price Sale price $196.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse Midkine/MDK Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP02865-10, RP02865-20, RP02865-50, RP02865-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse Midkine/MDK Protein is produced by E. coli expression system. The target protein is expressed with sequence (Lys23-Asp140) of mouse Midkine (Accession #NP_001012335.1) fused with no additional amino acid.

Alternate Names: MK; ARAP; MDK; MEK; MK1; MKARAP; NEGF2

SWISS: P12025

GeneID: 17242

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Midkine is a heparin-binding growth factor, originally reported as the product of a retinoic acid-responsive gene during embryogenesis, but currently viewed as a multifaceted factor contributing to both normal tissue homeostasis and disease development. Midkine is abnormally expressed at high levels in various human malignancies and acts as a mediator for the acquisition of critical hallmarks of cancer, including cell growth, survival, metastasis, migration, and angiogenesis.

Source: E. coli

Tag: No tag

Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: KKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details