ABclonal
Recombinant Mouse MUP-1 Protein - RP01588LQ
Recombinant Mouse MUP-1 Protein - RP01588LQ
Couldn't load pickup availability
Recombinant Mouse MUP-1 Protein
Sizes: 10ug, 20ug, 100ug
Catalogue Numbers: RP01588LQ-10, RP01588LQ-20, RP01588LQ-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse MUP-1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu19-Glu180) of mouse MUP-1 (Accession #NP_001186924.1) fused with a 6×His tag at the C-terminus.
Alternate Names: Major urinary protein 1, Mup7, Up-1, Ltn-1, Mup-1, Mup-a, Mup10, Lvtn-1, MUP1, Major urinary protein 1, Mup7, Up-1, Ltn-1, Mup-1, Mup-a, Mup10, Lvtn-1, MUP1
SWISS: P11588
GeneID: 17840
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Background: Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.
Source: HEK293 cells
Tag: C-His
Formulation: Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.
Antigen Sequence: EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEKHGILRENIIDLSNANRCLQARE
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
