ABclonal
Recombinant Mouse MYDGF Protein - RP01822
Recombinant Mouse MYDGF Protein - RP01822
Couldn't load pickup availability
Recombinant Mouse MYDGF Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01822-10, RP01822-20, RP01822-50, RP01822-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse MYDGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val25-Leu166) of mouse MYDGF (Accession #NP_543027.1) fused with a 6×His tag at the C-terminus.
Alternate Names: Mydgf, Myeloid-derived growth factor, MYDGF
SWISS: Q9CPT4
GeneID: 28106
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Myeloid-derived growth factor (MYDGF) is a secreted protein which belongs to the UPF0556 family. MYDGF was strongly expressed in spleen, prostate and lung, and weakly expressed in the left ventricle and liver. Bone marrow-derived monocyte and paracrine-acting protein promotes cardiac myocyte survival and adaptive angiogenesis for cardiac protection and/or repair after myocardial infarction (MI). MYDGF stimulates endothelial cell proliferation through a MAPK1/3-, STAT3- and CCND1-mediated signaling pathway. It inhibits cardiac myocyte apoptosis in a PI3K/AKT-dependent signaling pathway. MYDGF is involved in endothelial cell proliferation and angiogenesis. It may serve as a prototypical example for the development of protein-based therapies for ischemic tissue repair.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: VSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLKSEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only
