ABclonal
Recombinant Mouse NKG2-D/KLRK1/CD314 Protein - RP02720
Recombinant Mouse NKG2-D/KLRK1/CD314 Protein - RP02720
Couldn't load pickup availability
Recombinant Mouse NKG2-D/KLRK1/CD314 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP02720-10, RP02720-20, RP02720-50, RP02720-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse NKG2-D/KLRK1/CD314 Protein is expressed by HEK293 cells expression system. The target protein is expressed with sequence Phe90-Val232 of NKG2D/CD314 (Accession #NP_149069.1) fused with a hFc at the N-terminus
Alternate Names: CD314; D12S2489E; KLR; NKG2-D; NKG2D
SWISS: O54709-1
GeneID: 27007
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE; ≥ 95 % as determined by HPLC.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: NKG2D is a type II transmembrane glycoprotein having an extracellular lectin-like domain. This domain lacks the recognizable calcium-binding sites found in true C-type lectins and binds protein rather than carbohydrate ligands. Human NKG2D is expressed on CD8 alpha beta T cells, gamma δ T cells, NK cells and NKT cells.
Source: HEK293 cells
Tag: N-hFc
Antigen Sequence: FKETFQPVLCNKEVPVSSREGYCGPCPNNWICHRNNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCANLNTYICMKRAV
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
