Recombinant Mouse Nkrp1c/NK1.1/CD161c Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP01978-20, RP01978-50, RP01978-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Nkrp1c/NK1.1/CD161c Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln67-Ser223) of Mouse Nkrp1c/NK1.1/CD161c (Accession #NP_001153376.1) fused with HIS and AVI at the N-terminus.
Alternate Names: Klrb1c, Ly55c, Nkrp1c, Killer cell lectin-like receptor subfamily B member 1C, CD161 antigen-like family member C, Lymphocyte antigen 55c, Ly-55c, NK1.1, NKR-P1.9, NKR-P1C, Natural killer cell surface protein P1-40, NKR-P1 40, CD161c
SWISS: P27814
GeneID: 17059
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Plays a stimulatory role on natural killer (NK) cells cytotoxicity. Activation by cross-linking of the receptor induces Ca2+ mobilization and interferon-gamma production.
Source: HEK293 cells
Tag: N-6HIS＆AVI
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTENGSCASILGDKVTPESCASDNRWICQKELNHETPSNDS
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only