ABclonal
Recombinant Mouse Noggin/NOG Protein - RP01308
Recombinant Mouse Noggin/NOG Protein - RP01308
Couldn't load pickup availability
Recombinant Mouse Noggin/NOG Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01308-10, RP01308-20, RP01308-50, RP01308-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Noggin/NOG Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln28-Cys232) of mouse Noggin (Accession #NP_032737.1) fused with an 6×His tag at the C-terminus.
Alternate Names: noggin, NOG
SWISS: P97466
GeneID: 18121
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Noggin is a secreted protein involved at multiple stages of vertebrate embryonic development including neural induction and is known to exert its effects by inhibiting the bone morphogenetic protein (BMP)-signaling pathway. It binds several BMPs with very high (picomolar) affinities, with a marked preference for BMP2 and BMP4 over BMP7. By binding tightly to BMPs, Noggin prevents BMPs from binding their receptors. Noggin binds the bone morphogenetic proteins (BMP) such as BMP-4 and BMP-7 and inhibits BMP signaling by blocking the molecular interfaces of the binding epitopes for both types I and type II receptors. Interaction of BMP and its antagonist Noggin governs various developmental and cellular processes, including embryonic dorsal-ventral axis, induction of neural tissue, the formation of joints in the skeletal system, and neurogenesis in the adult brain. Noggin plays a key role in neural induction by inhibiting BMP4, along with other TGF-β signaling inhibitors such as chordin and follistatin. Mouse knockout experiments have demonstrated that noggin also plays a crucial role in bone development, joint formation, and neural tube fusion.
Bio-Activity: 1.Measured by its binding ability in a functional ELISA.Immobilized Human BMP4 at 0.5 μg/mL (100 μL/well) can bind Noggin with a linear range of 4-29 ng/mL.|2.Measured by its binding ability in a functional ELISA.Immobilized Human Noggin at 1 μg/mL (100 μL/well) can bind Noggin Rabbit pAb with a linear range of 1-4.95 ng/mL.|3.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 3.5-14 ng/mL in the presence of 50 ng/mL of Recombinant Human BMP-4.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
