ABclonal
Recombinant Mouse Parathormone/PTH Protein - RP01578
Recombinant Mouse Parathormone/PTH Protein - RP01578
Couldn't load pickup availability
Recombinant Mouse Parathormone/PTH Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01578-10, RP01578-20, RP01578-50, RP01578-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Parathormone/PTH Protein is produced by E. coli expression system. The target protein is expressed with sequence (Lys26-Gln115) of mouse Parathormone/PTH (Accession #NM_020623.2) fused with no additional amino acid.
Alternate Names: Parathyroid Hormone, PTH, Parathormone, Parathyrin, PTH
SWISS: Q9Z0L6
GeneID: 19226
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration inextracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cellsin bone and kidney. Another hormone, parathyroid hormone-related protein, binds to the same receptor asparathyroid hormone and has major effects on development. Like most other protein hormones, parathyroidhormone is synthesized as a preprohormone. After intracellular processing, the mature hormone is packagedwithin the Golgi into secretory vesicles, the secreted into blood by exocytosis. Parathyroid hormone is secretedas a linear protein of 84 amino acids.
Source: E. coli
Tag: No tag
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: KPVRKRAVSEIQLMHNLGKHLASMERMQWLRRKLQDMHNFVSLGVQMAARDGSHQKPTKKEENVLVDGNPKSLGEGDKADVDVLVKSKSQ
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only
