Skip to product information
1 of 1

ABclonal

Recombinant Mouse PD-1/PDCD1/CD279 Protein - RP01170

Recombinant Mouse PD-1/PDCD1/CD279 Protein - RP01170

Regular price $168.00 CAD
Regular price Sale price $168.00 CAD
Sale Sold out
Size
Quantity

Get a quote

Recombinant Mouse PD-1/PDCD1/CD279 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01170-10, RP01170-20, RP01170-50, RP01170-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse PD-1/PDCD1/CD279 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu25-Gln167) of mouse PD-1 (Accession #NP_032824.1) fused with a 6×His tag at the C-terminus.

Alternate Names: CD279, mPD-1, SLEB2, PDCD1, PD1, PD1/CD279/PDCD1, CD279, mPD-1, SLEB2, PDCD1, PD1, PD1/CD279/PDCD1

SWISS: Q02242

GeneID: 18566

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: Immobilized Recombinant Mouse PD-1 (Catalog: RP01170) at 1 ug/mL (100uL/well) can bind Anti-mouse PD-1 (CD279) with a linear range of 4.11-75.65 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only

View full details