Recombinant Mouse PD-1/PDCD1/CD279 Protein
Sizes: 10ug, 20ug
Catalogue Number: RP01177-10, RP01177-20
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse PD-1/PDCD1/CD279 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu25-Gln167) of mouse PD-1 (Accession #NP_032824.1) fused with an Fc tag at the C-terminus.
Alternate Names: CD279, mPD-1, SLEB2, PDCD1, PD1, PD1/CD279/PDCD1, CD279, mPD-1, SLEB2, PDCD1, PD1, PD1/CD279/PDCD1
SWISS: Q02242
GeneID: 18566
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: HEK293 cells
Tag: C-hFc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only