ABclonal
Recombinant Mouse PDGF-BB Protein - RP01745
Recombinant Mouse PDGF-BB Protein - RP01745
Couldn't load pickup availability
Recombinant Mouse PDGF-BB Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01745-10, RP01745-20, RP01745-50, RP01745-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse PDGF-BB Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser82-Thr190) of mouse PDGF subunit B/PDGF-2/PDGFB (Accession #NP_035187.2) fused with a 6×His tag at the C-terminus.
Alternate Names: Sis; c-sis; PDGF-2; PDGF-B; PDGFB
SWISS: P31240
GeneID: 18591
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: PDGFs are mitogenic during early developmental stages, driving the proliferation of undifferentiated mesenchyme and some progenitor populations. During later maturation stages, PDGF signalling has been implicated in tissue remodelling and cellular differentiation, and in inductive events involved in patterning and morphogenesis. In addition to driving mesenchymal proliferation, PDGFs have been shown to direct the migration, differentiation and function of a variety of specialised mesenchymal and migratory cell types, both during development and in the adult animal. Other growth factors in this family include vascular endothelial growth factors B and C (VEGF-B, VEGF-C)which are active in angiogenesis and endothelial cell growth, and placenta growth factor (PlGF) which is also active in angiogenesis. PDGF plays a role in embryonic development, cell proliferation, cell migration, and angiogenesis. PDGF is a required element in cellular division for fibroblast, a type of connective tissue cell. PDGF is also known to maintain proliferation of oligodendrocyte progenitor cells. Platelet-derived growth factor subunit B is also known as PDGFB, FLJ12858, PDGF2, SIS, SSV, c-sis, is a member of the platelet-derived growth factor family. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma.
Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human PDGFB (Catalog: RP01745) at 2 μg/mL (100 μL/well) can bind Human PDGFRB (Catalog: RP00126) with a linear range of 12-153 ng/mL.
Source: HEK293 cells
Tag: C-6His
Formulation: Lyophilized from a 0.22 μm filtered solution of 20mMNaAc-Hac pH4.5
Antigen Sequence: SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only
